McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF83-4:1

Chromosome

chr19

Gene Name

lnc-ZNF83-4

Start

52575882

CPC Label

noncoding

End

52585561

Cancer

CCRC

Strand

-

Peptide

GGVCRIPGPGRGR

Modified Peptide

n[230]GGVCRIPGPGRGR

Peptide Length

13

ORF Length

88

Open Reading Frame (ORF)

MFNIHLPGNFTFQACLPGTTGRGWKKRVASRRSTFSWGWNWGEAGPARGGRWWAMAPSDRGGVCRIPGPGRGRGLPGSGAAALPSRRR

Conservation Score

0.361

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.104422

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1091

PhyloCSF Frame 3

0

CNTI Score

-0.292699722