McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF823-4:1

Chromosome

chr19

Gene Name

lnc-ZNF823-4

Start

11831939

CPC Label

coding

End

11869344

Cancer

CRC

Strand

-

Peptide

FLSSVSPTMHSKV

Modified Peptide

‚Äč

Peptide Length

13

ORF Length

37

Open Reading Frame (ORF)

LCPFMTLKVIHISEGFPTFLTFIRFLSSVSPTMHSKV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.843649

PhyloCSF Frame 2 

-1.275

CNTI Index

noncoding

Max Probability

0.6153

PhyloCSF Frame 3

0

CNTI Score

-0.362897819