McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF821-3:1

Chromosome

chr16

Gene Name

lnc-ZNF821-3

Start

71807906

CPC Label

noncoding

End

71809084

Cancer

CCRC

Strand

-

Peptide

EAGPGEAGSPR

Modified Peptide

n[230]EAGPGEAGSPR

Peptide Length

11

ORF Length

69

Open Reading Frame (ORF)

LWVLRREDREAGPGEAGSPRGCSDFWRADPEASDREVPRAAAFRVVALPRRSWPCGRQRLIILPVFLIA

Conservation Score

1

PhyloCSF Frame 1

2.483

No. of Spectra

4

CPC Coding Probability

0.0123891

PhyloCSF Frame 2 

1.962

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

-2.021

CNTI Score

-0.362443937