McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF81-1:3

Chromosome

chrX

Gene Name

lnc-ZNF81-1

Start

47722330

CPC Label

coding

End

47725932

Cancer

OV

Strand

+

Peptide

LDTGHLTAASNAEVR

Modified Peptide

n[145]LDTGHLTAASNAEVR

Peptide Length

15

ORF Length

64

Open Reading Frame (ORF)

LDTGHLTAASNAEVRASPEVPDGSGATGSKGGTWATATPQLLSEEDLPWHCDLYQDTCRGDFLG

Conservation Score

1

PhyloCSF Frame 1

-3.536

No. of Spectra

297

CPC Coding Probability

0.976487

PhyloCSF Frame 2 

-4.56

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-4.814

CNTI Score

-0.272928831