McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF804B-1:1

Chromosome

chr7

Gene Name

lnc-ZNF804B-1

Start

88710630

CPC Label

noncoding

End

88756725

Cancer

OV

Strand

+

Peptide

LKPTQDWVLSK

Modified Peptide

n[145]LKPTQDWVLSK

Peptide Length

11

ORF Length

79

Open Reading Frame (ORF)

LKPTQDWVLSKACGNHCLVTTYVHSRRSLSTYPPQLGLCWVISEASTHLSLIQGPHLVRKIHIVTRKRWRKKRKQKKMY

Conservation Score

0.232

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0452565

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.707

PhyloCSF Frame 3

0

CNTI Score

-0.429429831