McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF804A-3:3

Chromosome

chr2

Gene Name

lnc-ZNF804A-3

Start

183997292

CPC Label

noncoding

End

184392434

Cancer

OSCC

Strand

+

Peptide

YNILGTK

Modified Peptide

n[145]YNILGTK

Peptide Length

7

ORF Length

51

Open Reading Frame (ORF)

LRLETAQSLTDCKTQKYNILGTKGKHNDTEGNIEVPKLGILDFRPSVPLTA

Conservation Score

0.794

PhyloCSF Frame 1

-5.429

No. of Spectra

1

CPC Coding Probability

0.185809

PhyloCSF Frame 2 

-5.417

CNTI Index

noncoding

Max Probability

0.9977

PhyloCSF Frame 3

-5.805

CNTI Score

-0.380206172