McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF800-7:1

Chromosome

chr7

Gene Name

lnc-ZNF800-7

Start

126868766

CPC Label

noncoding

End

126870532

Cancer

PRAD

Strand

-

Peptide

KWFIDMESISHEDAMNIVEMSTK

Modified Peptide

KWFIDM[147]ESISHEDAMNIVEMSTK

Peptide Length

23

ORF Length

38

Open Reading Frame (ORF)

LLLMDEQRKWFIDMESISHEDAMNIVEMSTKTYNFLQT

Conservation Score

0.053

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0373737

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5054

PhyloCSF Frame 3

0

CNTI Score

-0.3535946