McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF8-5:2

Chromosome

chr19

Gene Name

lnc-ZNF8-5

Start

58267370

CPC Label

noncoding

End

58273812

Cancer

OV

Strand

+

Peptide

LFNVIDTMFSEK

Modified Peptide

n[145]LFNVIDTMFSEK

Peptide Length

12

ORF Length

99

Open Reading Frame (ORF)

MRTRTGSLKLQVRLFNVIDTMFSEKQNACCLVLQRNSTQNINLILSARPFLLSAERVLITDGTMARAHLNKGGKQFLFLRQFVPATVSCLRWLEPACTI

Conservation Score

0.542

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.141299

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8521

PhyloCSF Frame 3

0

CNTI Score

-0.331247081