McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF791-5:1

Chromosome

chr19

Gene Name

lnc-ZNF791-5

Start

12560203

CPC Label

noncoding

End

12560474

Cancer

CCRC

Strand

+

Peptide

VLSNMEIGTSLFDEEGAK

Modified Peptide

n[230]VLSNMEIGTSLFDEEGAK

Peptide Length

18

ORF Length

79

Open Reading Frame (ORF)

LIKNMLGKVNEMIIGSGMACTFLKVLSNMEIGTSLFDEEGAKTVKDLMSKAEKNGVKIILPVDFVTAGKFDENTKTGQA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0323241

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

0.684012338