McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF783-1:1

Chromosome

chr7

Gene Name

lnc-ZNF783-1

Start

149398203

CPC Label

noncoding

End

149401456

Cancer

OSCC

Strand

+

Peptide

IVGLASLHNFMNQLLK

Modified Peptide

n[145]IVGLASLHNFM[147]NQLLK

Peptide Length

16

ORF Length

39

Open Reading Frame (ORF)

LPLLYSDSYSLIPIRKIVGLASLHNFMNQLLKINLHIDR

Conservation Score

0.053

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.040169

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9466

PhyloCSF Frame 3

0

CNTI Score

-0.35009534