McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF781-2:6

Chromosome

chr19

Gene Name

lnc-ZNF781-2

Start

37654714

CPC Label

noncoding

End

37655465

Cancer

OV

Strand

-

Peptide

LGLGAGRHCGRCFSEGK

Modified Peptide

n[145]LGLGAGRHCGRCFSEGK

Peptide Length

17

ORF Length

62

Open Reading Frame (ORF)

LGYPLSRVRLGLGAGRHCGRCFSEGKERGVGQVLQAGPRWRKGSCGASGRCAFFPGTELLQP

Conservation Score

0.009

PhyloCSF Frame 1

0.616

No. of Spectra

107

CPC Coding Probability

0.0119933

PhyloCSF Frame 2 

-1.753

CNTI Index

noncoding

Max Probability

0.8166

PhyloCSF Frame 3

-3.223

CNTI Score

-0.31913379