McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF778-3:1

Chromosome

chr16

Gene Name

lnc-ZNF778-3

Start

89249819

CPC Label

noncoding

End

89255339

Cancer

OV

Strand

+

Peptide

SVAQAGAK

Modified Peptide

n[145]SVAQAGAK

Peptide Length

8

ORF Length

42

Open Reading Frame (ORF)

LFLFFFFFFFFETESRSVAQAGAKWRHLGSLQAPSPGFTPFS

Conservation Score

0.097

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0785264

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4923

PhyloCSF Frame 3

0

CNTI Score

-0.350659211