McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF77-3:1

Chromosome

chr19

Gene Name

lnc-ZNF77-3

Start

2874949

CPC Label

noncoding

End

2875592

Cancer

BRCA-Luminal B

Strand

-

Peptide

LEGGGPRPFWLPISRVSR

Modified Peptide

n[145]LEGGGPRPFWLPISRVSR

Peptide Length

18

ORF Length

68

Open Reading Frame (ORF)

LEGGGPRPFWLPISRVSRTKGSTQFFLIEGVYVQDETEFYLGKRHAYVYKANNNTVTPGGKPNQTRII

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0305562

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8832

PhyloCSF Frame 3

0

CNTI Score

-0.417699075