McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF75D-3:1

Chromosome

chrX

Gene Name

lnc-ZNF75D-3

Start

135464328

CPC Label

noncoding

End

135465484

Cancer

LUAD

Strand

-

Peptide

ALTLQPLR

Modified Peptide

n[230]ALTLQPLR

Peptide Length

8

ORF Length

89

Open Reading Frame (ORF)

LGEWHDSGIHLQVWRYFALTDDHKRLILFHTKPWQCLSVRTMARRCRALTLQPLRRRSWWPTNLEMCTPFWFQSHTDAADLTWHTCQCC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0273763

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6565

PhyloCSF Frame 3

0

CNTI Score

-0.323355921