McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF74-7:2

Chromosome

chr22

Gene Name

lnc-ZNF74-7

Start

20320157

CPC Label

noncoding

End

20332636

Cancer

OSCC

Strand

+

Peptide

AVHNPELVMRR

Modified Peptide

n[145]AVHNPELVM[147]RR

Peptide Length

11

ORF Length

112

Open Reading Frame (ORF)

LPWRAVHNPELVMRRAPWPPGHWCVISIPSGYERSRLKVTLPEEGRGALPFLVSVAISSGSCSDNNAAVPTVLEGATTVISAAAVLRDPHDGAREIILEAMTISAVAIAAEM

Conservation Score

0.229

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.238092

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5239

PhyloCSF Frame 3

0

CNTI Score

-0.295375325