McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF738-6:1

Chromosome

chr19

Gene Name

lnc-ZNF738-6

Start

21383460

CPC Label

coding

End

21388581

Cancer

CCRC

Strand

+

Peptide

LLNSPQTLLLMKIHSGEKPYK

Modified Peptide

n[230]LLNSPQTLLLM[147]KIHSGEKPYK

Peptide Length

21

ORF Length

294

Open Reading Frame (ORF)

LKRNPTNVRNVAKLLNSPQTLLLMKIHSGEKPYKCGECGKAFFRFSYLTTHKIIHTGEKPYKCEECGKAFNCYSYLTAHKLIHTGEKPYKCEECGKAFYRFIYLTTHKRIHTGEKPYKCEECGKAFYRLSYLTTHKMIHTVEKRYKCEECGKAFNWYSRLTTHKRIHTGEKPYKCEECGKAFSVFSTLTKHKIIHTGERPYKCEECGKAFNVFSTLTKHKRIHNGEKPYKCLECGKDFYQFSYLTTHKMIHTGERPYKHEESGKAFNCSSQITRHKIIHTGEKPYKCEECGKAF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.99764

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.1228

PhyloCSF Frame 3

0

CNTI Score

0.713209298