McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF736-7:1

Chromosome

chr7

Gene Name

lnc-ZNF736-7

Start

64433927

CPC Label

coding

End

64435116

Cancer

CCRC

Strand

+

Peptide

AAFDDTIAELDTLSEESYK

Modified Peptide

n[230]AAFDDTIAELDTLSEESYK

Peptide Length

19

ORF Length

52

Open Reading Frame (ORF)

LLSNFSVFYYEILNSPDHACRLAKAAFDDTIAELDTLSEESYKDTMDFRHAG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.973101

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9951

PhyloCSF Frame 3

0

CNTI Score

0.668405005