McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF735-4:1

Chromosome

chr7

Gene Name

lnc-ZNF735-4

Start

64140494

CPC Label

noncoding

End

64150058

Cancer

OV

Strand

+

Peptide

ALESGMIPTRK

Modified Peptide

n[145]ALESGM[147]IPTRK

Peptide Length

11

ORF Length

44

Open Reading Frame (ORF)

LDKRITMKALESGMIPTRKTSLDNDRVTNSLLMVTFIGESEQYL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.046775

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5895

PhyloCSF Frame 3

0

CNTI Score

-0.381467811