McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF727-9:1

Chromosome

chr7

Gene Name

lnc-ZNF727-9

Start

63931140

CPC Label

noncoding

End

63931968

Cancer

OSCC

Strand

+

Peptide

GGHISHGRHQGEVHPPPDLPR

Modified Peptide

n[145]GGHISHGRHQGEVHPPPDLPR

Peptide Length

21

ORF Length

109

Open Reading Frame (ORF)

LLCRSIPKAALGSECSCSSAARRGMPRDGLTTTQAAVRLGRPRGRGRGGHISHGRHQGEVHPPPDLPRRPVQRSLPPGLGRLCGNKGTQRGLTAPALKQGWNQAIRFFS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.124586

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.1533

PhyloCSF Frame 3

0

CNTI Score

0.710087004