McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF727-8:1

Chromosome

chr7

Gene Name

lnc-ZNF727-8

Start

64085559

CPC Label

noncoding

End

64086576

Cancer

PRAD

Strand

+

Peptide

HLLGEVEANSMQFKPGIADR

Modified Peptide

HLLGEVEANSM[147]QFKPGIADR

Peptide Length

20

ORF Length

43

Open Reading Frame (ORF)

MDILAKLSENLVKFLDYVSTFKHLLGEVEANSMQFKPGIADRC

Conservation Score

0.017

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.0192143

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9921

PhyloCSF Frame 3

0

CNTI Score

-0.413915021