McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF716-12:1

Chromosome

chr7

Gene Name

lnc-ZNF716-12

Start

57192693

CPC Label

noncoding

End

57194068

Cancer

EOGC

Strand

+

Peptide

MLILTHLAPILLLSLNPK

Modified Peptide

n[145]MLILTHLAPILLLSLNPK

Peptide Length

18

ORF Length

69

Open Reading Frame (ORF)

LIKHHHYAYRTNILITALYSLYMLITTQGTLTYYINSIKPSSTQEKMLILTHLAPILLLSLNPKIIIGF

Conservation Score

1

PhyloCSF Frame 1

10.755

No. of Spectra

3

CPC Coding Probability

0.0586889

PhyloCSF Frame 2 

8.634

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

-5.775

CNTI Score

-0.396868949