McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF716-10:1

Chromosome

chr7

Gene Name

lnc-ZNF716-10

Start

57216133

CPC Label

noncoding

End

57221710

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LQVEGHGAGNLGR

Modified Peptide

n[145]LQVEGHGAGNLGR

Peptide Length

13

ORF Length

65

Open Reading Frame (ORF)

LVLLLLKAEGCGAGDLGVAGVAVVQVRGSWGLRYREELVLRLQVEGHGAGNLGRSHCCCSSLRVV

Conservation Score

0.998

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0813101

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9199

PhyloCSF Frame 3

0

CNTI Score

-0.317284787