McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF713-5:1

Chromosome

chr7

Gene Name

lnc-ZNF713-5

Start

55736778

CPC Label

noncoding

End

55739596

Cancer

OV

Strand

+

Peptide

AQGTGDREGGVLFTARALDQCRP

Modified Peptide

n[145]AQGTGDREGGVLFTARALDQCRP

Peptide Length

23

ORF Length

86

Open Reading Frame (ORF)

LGFGGRGRGNPTDMDPALEDPTTLKCKMRRCSSCSPKPNTPKCAMCDGDSFPFACTGGRSRGRAQGTGDREGGVLFTARALDQCRP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.43392

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.3563

PhyloCSF Frame 3

0

CNTI Score

0.74181105