McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF708-2:9

Chromosome

chr19

Gene Name

lnc-ZNF708-2

Start

21438492

CPC Label

noncoding

End

21463904

Cancer

OV

Strand

-

Peptide

AASLADTELK

Modified Peptide

n[145]AASLADTELK

Peptide Length

10

ORF Length

74

Open Reading Frame (ORF)

LWPKPSQKMKVRAASLADTELKKKAQREQEKPVLQEPPEGIKIPTPYVTAYPTLPRPAAPWEPDSGASTPQLSP

Conservation Score

0.421

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.384989

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8021

PhyloCSF Frame 3

0

CNTI Score

-0.324186519