McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF708-14:8

Chromosome

chr19

Gene Name

lnc-ZNF708-14

Start

21551376

CPC Label

noncoding

End

21555076

Cancer

HCC

Strand

-

Peptide

LRDFVTTRPPLEEVLK

Modified Peptide

n[43]LRDFVTTRPPLEEVLK

Peptide Length

16

ORF Length

37

Open Reading Frame (ORF)

MLRDFVTTRPPLEEVLKEALNMERKNQYQPLQKHIEL

Conservation Score

0.323

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0437771

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.88

PhyloCSF Frame 3

0

CNTI Score

-0.328863817