McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF706-2:3

Chromosome

chr8

Gene Name

lnc-ZNF706-2

Start

101119766

CPC Label

noncoding

End

101124667

Cancer

CCRC

Strand

-

Peptide

RSLTFLPR

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

99

Open Reading Frame (ORF)

MCVYICVCVCVCVCVCVCVCVLFVCFPRRSLTFLPRLEGGGVISAHCNLRLLGSSDSPASASRVAGITGVHHHARLVFVCLIEMGFHYVGQAGLEFLTS

Conservation Score

0.836

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0935406

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6123

PhyloCSF Frame 3

0

CNTI Score

-0.332191443