McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF706-1:1

Chromosome

chr8

Gene Name

lnc-ZNF706-1

Start

101166804

CPC Label

noncoding

End

101169629

Cancer

CCRC

Strand

-

Peptide

HNGYIDYR

Modified Peptide

n[230]HNGYIDYR

Peptide Length

8

ORF Length

52

Open Reading Frame (ORF)

LTLLSSFFFFFLASRCVIHRHNGYIDYRSLKLLIQMLNRRKTSSLPTWHLIL

Conservation Score

0.197

PhyloCSF Frame 1

-4.492

No. of Spectra

3

CPC Coding Probability

0.197775

PhyloCSF Frame 2 

-5.912

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-5.786

CNTI Score

-0.321591902