McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF705D-2:51

Chromosome

chr8

Gene Name

lnc-ZNF705D-2

Start

12437012

CPC Label

noncoding

End

12551049

Cancer

EOGC

Strand

+

Peptide

LLPSPGDHAAVMSSFLNSIRK

Modified Peptide

n[145]LLPSPGDHAAVM[147]SSFLNSIRK

Peptide Length

21

ORF Length

60

Open Reading Frame (ORF)

LLPSPGDHAAVMSSFLNSIRKTCPLALSKRIVLEGRSGTKKDAVFICIGKCENKIDNSFS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0390799

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8254

PhyloCSF Frame 3

0

CNTI Score

-0.330343555