McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF705D-2:35

Chromosome

chr8

Gene Name

lnc-ZNF705D-2

Start

12194268

CPC Label

noncoding

End

12553101

Cancer

OV

Strand

+

Peptide

AGPSPGLGPGR

Modified Peptide

n[145]AGPSPGLGPGR

Peptide Length

11

ORF Length

51

Open Reading Frame (ORF)

MVFRRGARGGAQDPELRAGPSPGLGPGRRGQLGRGSLGSSVQVWGPGGGAS

Conservation Score

0.021

PhyloCSF Frame 1

-4.198

No. of Spectra

1

CPC Coding Probability

0.0564864

PhyloCSF Frame 2 

-4.41

CNTI Index

noncoding

Max Probability

0.5904

PhyloCSF Frame 3

-3.418

CNTI Score

-0.313289059