McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF683-7:1

Chromosome

chr1

Gene Name

lnc-ZNF683-7

Start

26489783

CPC Label

noncoding

End

26500962

Cancer

EOGC

Strand

-

Peptide

VLEPGGFR

Modified Peptide

n[145]VLEPGGFR

Peptide Length

8

ORF Length

34

Open Reading Frame (ORF)

MVREGKLGHKGRPGVVRVLEPGGFRFAFSSPLPY

Conservation Score

0.153

PhyloCSF Frame 1

-4.733

No. of Spectra

45

CPC Coding Probability

0.291052

PhyloCSF Frame 2 

-5.534

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

-4.263

CNTI Score

-0.317204356