McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF683-3:1

Chromosome

chr1

Gene Name

lnc-ZNF683-3

Start

26471305

CPC Label

noncoding

End

26472410

Cancer

OV

Strand

-

Peptide

ISAAFLPAPAGGPRR

Modified Peptide

n[145]ISAAFLPAPAGGPRR

Peptide Length

15

ORF Length

96

Open Reading Frame (ORF)

MQPSNPLLQAVRHSRRISAAFLPAPAGGPRRGVCEAWLHCPAPLEAGGSARLEAQAAVPRAQADAKVGKRRGNQLGAAGRASFRAATSEKPFVHLT

Conservation Score

1

PhyloCSF Frame 1

0.428

No. of Spectra

2

CPC Coding Probability

0.110583

PhyloCSF Frame 2 

-0.748

CNTI Index

noncoding

Max Probability

0.3588

PhyloCSF Frame 3

-1.784

CNTI Score

-0.293019845