McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF682-3:4

Chromosome

chr19

Gene Name

lnc-ZNF682-3

Start

20228009

CPC Label

noncoding

End

20238431

Cancer

EOGC

Strand

-

Peptide

TLNDLIELKTMAQK

Modified Peptide

n[145]TLNDLIELKTM[147]AQK

Peptide Length

14

ORF Length

159

Open Reading Frame (ORF)

MFFRQSVKTNFSKLKEDVRIHHKEAGNLEKRLDEWLTIIDSVEKTLNDLIELKTMAQKLRDECRSLSIQCDQQEEKVSVIVKMNEMKQEEKFRDKIIKRNEQSLQEIWDYVKRPNLRLIGVPESDGENRTKLENTLQDIIQENFPNLARQADIQIQEIQ

Conservation Score

0.422

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.134918

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3545

PhyloCSF Frame 3

0

CNTI Score

-0.303768779