McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF680-9:2

Chromosome

chr7

Gene Name

lnc-ZNF680-9

Start

63241589

CPC Label

noncoding

End

63248321

Cancer

BRCA-Luminal B

Strand

-

Peptide

LLLFIYDR

Modified Peptide

n[145]LLLFIYDR

Peptide Length

8

ORF Length

92

Open Reading Frame (ORF)

LGKSTLINSLFLTDLYSPEYPGPSHRTKKTVQVCPLAINRSKLLLFIYDRTHMQDLKDVTNNVHCENYGSRKLAAVTYNGVDNNKNKGQLTK

Conservation Score

1

PhyloCSF Frame 1

2.687

No. of Spectra

1

CPC Coding Probability

0.0485727

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6562

PhyloCSF Frame 3

0

CNTI Score

-0.392423152