McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF679-1:1

Chromosome

chr7

Gene Name

lnc-ZNF679-1

Start

64318567

CPC Label

noncoding

End

64324320

Cancer

OSCC

Strand

+

Peptide

IWIHGIIVK

Modified Peptide

n[145]IWIHGIIVK

Peptide Length

9

ORF Length

34

Open Reading Frame (ORF)

MQLYSALLLTYYKIWIHGIIVKGFHLFLPHIHFC

Conservation Score

0.078

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0244065

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

0

CNTI Score

-0.400425756