McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF672-5:1

Chromosome

chr1

Gene Name

lnc-ZNF672-5

Start

248691967

CPC Label

noncoding

End

248699072

Cancer

OV

Strand

+

Peptide

LACSLTFMPFFTVSWEIK

Modified Peptide

n[145]LACSLTFM[147]PFFTVSWEIK

Peptide Length

18

ORF Length

95

Open Reading Frame (ORF)

LACSLTFMPFFTVSWEIKMSDLEEEDVDEFSSSGFKCPTCFAVQGRKCDTELKWCAADKIKCIEFSGIINTGIRDVAIEMKRCTQADLCKETITS

Conservation Score

1

PhyloCSF Frame 1

-2.254

No. of Spectra

1

CPC Coding Probability

0.465008

PhyloCSF Frame 2 

-4.263

CNTI Index

noncoding

Max Probability

0.798

PhyloCSF Frame 3

2.526

CNTI Score

-0.304614716