McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF671-1:1

Chromosome

chr19

Gene Name

lnc-ZNF671-1

Start

57753221

CPC Label

coding

End

57754937

Cancer

OSCC

Strand

-

Peptide

ITAYIRSFSR

Modified Peptide

n[145]ITAYIRSFSR

Peptide Length

10

ORF Length

46

Open Reading Frame (ORF)

LSTLIRSFSSANSLMIIKTITFASEFPRITAYIRSFSREKSLVKDK

Conservation Score

1

PhyloCSF Frame 1

-5.206

No. of Spectra

11

CPC Coding Probability

0.787748

PhyloCSF Frame 2 

-0.661

CNTI Index

noncoding

Max Probability

0.8429

PhyloCSF Frame 3

-4.571

CNTI Score

-0.400918098