McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF654-3:1

Chromosome

chr3

Gene Name

lnc-ZNF654-3

Start

88161433

CPC Label

noncoding

End

88167095

Cancer

CCRC

Strand

+

Peptide

LACFVFNSK

Modified Peptide

n[230]LACFVFNSK

Peptide Length

9

ORF Length

46

Open Reading Frame (ORF)

LACFVFNSKAHVFFLHFVYRLTTAISLISKIFNLNPQFLHMKKWTI

Conservation Score

0.197

PhyloCSF Frame 1

-4.789

No. of Spectra

1

CPC Coding Probability

0.0422308

PhyloCSF Frame 2 

-4.788

CNTI Index

noncoding

Max Probability

0.6544

PhyloCSF Frame 3

-4.554

CNTI Score

-0.380782778