McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF644-1:6

Chromosome

chr1

Gene Name

lnc-ZNF644-1

Start

90829546

CPC Label

noncoding

End

90836161

Cancer

OV

Strand

-

Peptide

TLDGGVAR

Modified Peptide

n[145]TLDGGVAR

Peptide Length

8

ORF Length

102

Open Reading Frame (ORF)

LRPRTLDGGVARRRASPAWVGLPFALEAGLSAGGPLANPEVDTREMGGIGKGTQPFRPFPQSRPASLPCGCRRLQCHSPGFRLGRRRDCRPDPNAEALRLLM

Conservation Score

1

PhyloCSF Frame 1

-2.197

No. of Spectra

2

CPC Coding Probability

0.128006

PhyloCSF Frame 2 

-3.988

CNTI Index

noncoding

Max Probability

0.922

PhyloCSF Frame 3

-2.929

CNTI Score

-0.350798091