McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF644-1:23

Chromosome

chr1

Gene Name

lnc-ZNF644-1

Start

90838546

CPC Label

noncoding

End

90851618

Cancer

PRAD

Strand

-

Peptide

LHVSGPFK

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

63

Open Reading Frame (ORF)

LHVSGPFKHGSRCPVVNTLTFIQCLLHLNLINSINELEQGNVPVVRMLCFCGIILCSFPICWR

Conservation Score

1

PhyloCSF Frame 1

0.83

No. of Spectra

3

CPC Coding Probability

0.160654

PhyloCSF Frame 2 

-1.932

CNTI Index

coding

Max Probability

0.994

PhyloCSF Frame 3

2.29

CNTI Score

0.667172158