McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF627-2:13

Chromosome

chr19

Gene Name

lnc-ZNF627-2

Start

11639802

CPC Label

coding

End

11663769

Cancer

EOGC

Strand

+

Peptide

SAVEEGGR

Modified Peptide

n[145]SAVEEGGR

Peptide Length

8

ORF Length

47

Open Reading Frame (ORF)

LSGFKSAVEEGGRGKVGIAREATDSRTFQTQSFRGWLVLRKVVRFVR

Conservation Score

0.87

PhyloCSF Frame 1

0

No. of Spectra

53

CPC Coding Probability

0.999929

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

0.738643018