McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF626-5:1

Chromosome

chr19

Gene Name

lnc-ZNF626-5

Start

20966511

CPC Label

noncoding

End

20971891

Cancer

OV

Strand

-

Peptide

MPQSTLWVGPR

Modified Peptide

n[145]MPQSTLWVGPR

Peptide Length

11

ORF Length

36

Open Reading Frame (ORF)

MPQSTLWVGPRRKSNTTQKMGSDNQSSTSKARNAPP

Conservation Score

0.263

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0761386

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9954

PhyloCSF Frame 3

0

CNTI Score

-0.45588038