McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF624-5:1

Chromosome

chr17

Gene Name

lnc-ZNF624-5

Start

16787234

CPC Label

noncoding

End

16788141

Cancer

EOGC

Strand

-

Peptide

CNESMAK

Modified Peptide

n[145]CNESM[147]AK

Peptide Length

7

ORF Length

46

Open Reading Frame (ORF)

LTYIKLSMAIKCNESMAKGLQRALLQQQPEDDSKCFPPAPGPDPAL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0747787

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.931

PhyloCSF Frame 3

0

CNTI Score

-0.337955236