McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF621-5:1

Chromosome

chr3

Gene Name

lnc-ZNF621-5

Start

40761544

CPC Label

noncoding

End

40761799

Cancer

LUAD

Strand

+

Peptide

GLVQSPNSYFMDVK

Modified Peptide

GLVQSPNSYFMDVK

Peptide Length

14

ORF Length

84

Open Reading Frame (ORF)

MPLAKDLLHPSPEEEKRKHKKKGLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.112989

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9781

PhyloCSF Frame 3

0

CNTI Score

-0.37453415