McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF613-7:1

Chromosome

chr19

Gene Name

lnc-ZNF613-7

Start

52046933

CPC Label

noncoding

End

52049822

Cancer

OV

Strand

+

Peptide

DILSQTPTR

Modified Peptide

n[145]DILSQTPTR

Peptide Length

9

ORF Length

80

Open Reading Frame (ORF)

LTTRASMRDPKDILSQTPTRDSYQLPSKRKHPPPPPPTPALPPPYSATNNADALRKLPPTTFPRPDPHTDLTLLGIAATS

Conservation Score

0.545

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0566351

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9782

PhyloCSF Frame 3

0

CNTI Score

-0.356025663