McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF598-3:1

Chromosome

chr16

Gene Name

lnc-ZNF598-3

Start

1990469

CPC Label

noncoding

End

1992171

Cancer

OV

Strand

-

Peptide

YSAPRGPVESPQSPLK

Modified Peptide

n[145]YSAPRGPVESPQSPLK

Peptide Length

16

ORF Length

44

Open Reading Frame (ORF)

LIQARYSAPRGPVESPQSPLKSVGTGAFTWARDSQAGAGTAKGR

Conservation Score

0.239

PhyloCSF Frame 1

-4.219

No. of Spectra

5

CPC Coding Probability

0.248552

PhyloCSF Frame 2 

-3.569

CNTI Index

noncoding

Max Probability

0.6152

PhyloCSF Frame 3

-5.432

CNTI Score

-0.268926763