McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF593-1:1

Chromosome

chr1

Gene Name

lnc-ZNF593-1

Start

26172433

CPC Label

noncoding

End

26173530

Cancer

HCC

Strand

+

Peptide

AGQHFGRLRQADGLSPGVQDQPGQR

Modified Peptide

‚Äč

Peptide Length

25

ORF Length

39

Open Reading Frame (ORF)

MAGQHFGRLRQADGLSPGVQDQPGQRGETSSLPKKKKKI

Conservation Score

0.174

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0187889

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1657

PhyloCSF Frame 3

0

CNTI Score

-0.356021021