McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF582-6:6

Chromosome

chr19

Gene Name

lnc-ZNF582-6

Start

56346769

CPC Label

noncoding

End

56368053

Cancer

OV

Strand

-

Peptide

FQRPCAGYAGLLHR

Modified Peptide

n[145]FQRPCAGYAGLLHR

Peptide Length

14

ORF Length

40

Open Reading Frame (ORF)

LPSLASQSAGITGVSHRTLPFFCFFKFQRPCAGYAGLLHR

Conservation Score

0.467

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.148754

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9789

PhyloCSF Frame 3

0

CNTI Score

-0.337275754