McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF574-1:10

Chromosome

chr19

Gene Name

lnc-ZNF574-1

Start

42152568

CPC Label

noncoding

End

42157523

Cancer

BRCA-Luminal B

Strand

+

Peptide

LGLGHVDK

Modified Peptide

n[145]LGLGHVDK

Peptide Length

8

ORF Length

163

Open Reading Frame (ORF)

LGLGHVDKSLTPRPGFSGLSEEPELPLRPAPPIPGQPPRHTYTLGHGRMSSCAAKHPPHAALNSVPSTSPHQTQDESRSPRAKLLLPRHSGLPSGCVSTLGHMPVAYVWVTSVTLGPLHIEGRCVFLWKDGRTEGKERQSGTTALFLPWHLEGTRYPGDCSWL

Conservation Score

0.336

PhyloCSF Frame 1

-2.79

No. of Spectra

2

CPC Coding Probability

0.196384

PhyloCSF Frame 2 

-2.595

CNTI Index

noncoding

Max Probability

0.997

PhyloCSF Frame 3

-5

CNTI Score

-0.321950057