McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF573-1:6

Chromosome

chr19

Gene Name

lnc-ZNF573-1

Start

37833462

CPC Label

noncoding

End

37853547

Cancer

CCRC

Strand

-

Peptide

LYDVSNR

Modified Peptide

n[230]LYDVSNR

Peptide Length

7

ORF Length

38

Open Reading Frame (ORF)

LYDVSNRFSPWGECILSGIGPTDLIKTSAIDEIKLCSI

Conservation Score

0.046

PhyloCSF Frame 1

-5.029

No. of Spectra

1

CPC Coding Probability

0.0470371

PhyloCSF Frame 2 

-4.269

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

-5.53

CNTI Score

-0.390867871