McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF573-1:3

Chromosome

chr19

Gene Name

lnc-ZNF573-1

Start

37833367

CPC Label

noncoding

End

37855215

Cancer

OV

Strand

-

Peptide

SHCRPGWSAVGR

Modified Peptide

n[145]SHCRPGWSAVGR

Peptide Length

12

ORF Length

49

Open Reading Frame (ORF)

MVRLRHLPLLLPNALRHQTKSHCRPGWSAVGRSQLTATSASKVQVILLP

Conservation Score

0.007

PhyloCSF Frame 1

-4.195

No. of Spectra

2

CPC Coding Probability

0.0785804

PhyloCSF Frame 2 

-3.627

CNTI Index

noncoding

Max Probability

0.8574

PhyloCSF Frame 3

0

CNTI Score

-0.340405385